Description
LL-37 5mg
LL-37 (Cathelicidin Antimicrobial Peptide, CAMP) is a synthetic 37-amino acid human cathelicidin peptide representing the only known member of the human cathelicidin family. With the full sequence [LL-37, 37 aa], LL-37 is the C-terminal cleavage product of the hCAP-18 precursor protein and has been the subject of extensive cellular biology and biochemical research literature examining cathelicidin peptide chemistry, innate cellular immunity research, and antimicrobial peptide biology.
Each vial contains 5mg of lyophilized LL-37 in a sealed 3mL glass vial, verified through Mile High Compounds’ three-tier quality protocol: 7x independent third-party analytical testing, 4-vial batch conformity verification, and comprehensive heavy metal screening.
Product Specifications
- Compound: LL-37 (Cathelicidin Antimicrobial Peptide)
- Class: Synthetic human cathelicidin peptide, 37 amino acids
- Origin: C-terminal cleavage product of hCAP-18 precursor protein
- Sequence: [LL-37, 37 aa]
- Molecular Weight: ~4493 Da
- Form: Lyophilized powder
- Vial Size: 5mg in 3mL glass vial
- Purity: 99%+ verified by HPLC and mass spectrometry (See COAs)
Research Background
LL-37 has been investigated in research literature across several scientific contexts:
- Antimicrobial peptide research — investigations into cathelicidin peptide chemistry and structure-activity relationships in cellular research models
- Innate cellular immunity research — studies examining cellular response pathways involving cathelicidin peptides in cell culture systems
- Cathelicidin biology — research literature on the broader cathelicidin peptide family across mammalian cellular biology
- Cellular membrane interaction research — analytical chemistry studies on LL-37’s amphipathic alpha-helical structure and membrane interaction properties
- Peptide chemistry research — analytical studies on LL-37 structural properties and stability characteristics
- Comparative antimicrobial peptide research — cellular research positioning LL-37 alongside other antimicrobial peptides in cellular research contexts
LL-37 is notable in research literature as the only known human cathelicidin antimicrobial peptide and represents a foundational research subject in the broader field of host defense peptide biology. The peptide has been extensively characterized for its amphipathic alpha-helical structure and cellular membrane interaction properties. Foundational research is available through PubMed (pubmed.ncbi.nlm.nih.gov) and the National Institutes of Health’s PMC database (pmc.ncbi.nlm.nih.gov), where researchers can access peer-reviewed studies on LL-37 and cathelicidin peptide research.
Analytical Verification
Every batch undergoes Mile High Compounds’ comprehensive analytical protocol:
- High-Performance Liquid Chromatography (HPLC) for purity quantification
- Mass Spectrometry (MS) for molecular weight and identity confirmation
- 14-day sterility testing
- Endotoxin analysis
- 4-vial batch conformity verification — statistically robust consistency testing across each production batch, exceeding the industry-standard single-vial sampling approach
- Heavy metal screening for lead, arsenic, cadmium, mercury, and additional trace metals
- Container and seal integrity verification
Batch-specific Certificates of Analysis (COAs) accompany every order, documenting full testing results across all verification protocols.
Reconstitution and Storage
- Lyophilized storage: Cool, dry location away from direct light; -20°C for long-term stability
- Post-reconstitution: Refrigerate at 2-8°C, protect from light
- Reconstituted use window: 30 days for optimal research integrity
- Avoid: Repeated freeze-thaw cycles to preserve compound stability and structural integrity
Quality Standards
Mile High Compounds maintains a rigorous quality control framework across all research compounds. Our multi-layered testing protocol provides researchers with verified, high-purity reference materials supported by complete analytical documentation.
- 7x independent third-party testing per batch
- 4-vial batch conformity verification
- Heavy metal screening for trace contaminant analysis
- cGMP-compliant manufacturing
- Full analytical traceability
- Same-day shipping for orders placed before 3PM MST
Terms of Sale
This product is supplied for in vitro laboratory research only and has not been evaluated by the U.S. Food and Drug Administration. By purchasing, the buyer confirms they are 21 or older, a qualified research professional or institution, and will not use this material for human consumption, veterinary use, or any in vivo application. Mile High Compounds assumes no liability for misuse or off-label application.
About Mile High Compounds
Colorado-based research compound supplier specializing in high-purity reference materials for laboratory applications. Every batch undergoes our three-tier quality protocol: 7x independent third-party analytical verification, 4-vial batch conformity testing, and comprehensive heavy metal screening — manufactured in cGMP-compliant facilities.
Trusted by the research community with 4.9-star Trustpilot & PepReviewPro ratings and over 700+ verified customer reviews.
